Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein automated matches [190149] (9 species) not a true protein |
Species Francisella tularensis [TaxId:263] [324166] (3 PDB entries) |
Domain d5g1st_: 5g1s T: [324324] automated match to d3p2la_ complexed with act, mpd, mrd |
PDB Entry: 5g1s (more details), 1.7 Å
SCOPe Domain Sequences for d5g1st_:
Sequence, based on SEQRES records: (download)
>d5g1st_ c.14.1.1 (T:) automated matches {Francisella tularensis [TaxId: 263]} nlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiy fyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqim ihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeak ayglidhviesre
>d5g1st_ c.14.1.1 (T:) automated matches {Francisella tularensis [TaxId: 263]} nlvptviektgerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfy inspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimih qplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakay glidhviesre
Timeline for d5g1st_: