| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily) core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets duplication: consists of two structural repeats |
Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) ![]() binds to the transactivation domain of human p53 |
| Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins) Pfam PF02201 |
| Protein MDM2 [47594] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47596] (76 PDB entries) |
| Domain d4zfic_: 4zfi C: [324316] automated match to d5hmia_ complexed with 4nj |
PDB Entry: 4zfi (more details), 2 Å
SCOPe Domain Sequences for d4zfic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zfic_ a.42.1.1 (C:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc
sndllgdlfgvpsfsvkehrkiytmiyrnlvvv
Timeline for d4zfic_: