Lineage for d1g6ob_ (1g6o B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.13: Extended AAA-ATPase domain [52700] (10 proteins) 
Protein Hexameric traffic ATPase, HP0525 [52719] (1 species) Species Helicobacter pylori [TaxId:210] [52720] (1 PDB entry) 
Domain d1g6ob_: 1g6o B: [32431]
Details for d1g6ob_
PDB Entry: 1g6o (more details), 2.5 Å
PDB Description: crystal structure of the helicobacter pylori atpase, hp0525, in complex with adp
SCOP Domain Sequences for d1g6ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g6ob_ c.37.1.13 (B:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori}
lsaedkkfleveralkeaalnplrhateelfgdflkmeniteicyngnkvvwvlknngew
qpfdvrdrkafslsrlmhfarccasfkkktidnyenpilssnlangervqivlspvtvnd
etisisiripskttyphsffeeqgfynlldnkeqaisaikdgiaigknvivcggtgsgkt
tyiksimefipkeeriisiedteeivfkhhknytqlffggnitsadclksclrmrpdrii
lgelrsseaydfynvlcsghkgtlttlhagsseeafirlanmsssnsaarnikfeslieg
fkdlidmivhinhhkqcdefyik
SCOP Domain Coordinates for d1g6ob_:
Click to download the PDB-style file with coordinates for d1g6ob_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g6ob_:
- d1g6ob_ appears in SCOP 1.57
- d1g6ob_ appears in the current release, SCOPe 2.08
View in 3D
