Lineage for d1nsfa_ (1nsf A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2127737Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2127859Protein Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein [52717] (1 species)
  7. 2127860Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [52718] (2 PDB entries)
  8. 2127862Domain d1nsfa_: 1nsf A: [32429]
    complexed with atp, mg

Details for d1nsfa_

PDB Entry: 1nsf (more details), 1.9 Å

PDB Description: d2 hexamerization domain of n-ethylmaleimide sensitive factor (nsf)
PDB Compounds: (A:) n-ethylmaleimide sensitive factor

SCOPe Domain Sequences for d1nsfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nsfa_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
kpafgtnqedyasyimngiikwgdpvtrvlddgellvqqtknsdrtplvsvllegpphsg
ktalaakiaeesnfpfikicspdkmigfsetakcqamkkifddayksqlscvvvddierl
ldyvpigprfsnlvlqallvllkkappqgrklliigttsrkdvlqememlnafsttihvp
niatgeqllealellgnfkdkerttiaqqvkgkkvwigikkllmliemslqmdpeyrvrk
flallre

SCOPe Domain Coordinates for d1nsfa_:

Click to download the PDB-style file with coordinates for d1nsfa_.
(The format of our PDB-style files is described here.)

Timeline for d1nsfa_: