Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein [52717] (1 species) |
Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [52718] (2 PDB entries) |
Domain d1nsfa_: 1nsf A: [32429] complexed with atp, mg |
PDB Entry: 1nsf (more details), 1.9 Å
SCOPe Domain Sequences for d1nsfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nsfa_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} kpafgtnqedyasyimngiikwgdpvtrvlddgellvqqtknsdrtplvsvllegpphsg ktalaakiaeesnfpfikicspdkmigfsetakcqamkkifddayksqlscvvvddierl ldyvpigprfsnlvlqallvllkkappqgrklliigttsrkdvlqememlnafsttihvp niatgeqllealellgnfkdkerttiaqqvkgkkvwigikkllmliemslqmdpeyrvrk flallre
Timeline for d1nsfa_: