SCOPe 2.08: Domain d5lxva_: 5lxv A:

Lineage for d5lxva_ (5lxv A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.0: automated matches [191610] (1 protein)
   not a true family

6. Protein automated matches [191113] (13 species)
   not a true protein

7. Species Ruminococcus flavefaciens [TaxId:641112] [324254] (1 PDB entry)

8. Domain d5lxva_: 5lxv A: [324285]
   automated match to d3ul4a_
   complexed with ca

Details for d5lxva_

PDB Entry: 5lxv, 2.4 Å

PDB Description: crystal structure of ruminococcus flavefaciens scaffoldin c cohesin in complex with a dockerin from an uncharacterized cbm-containing protein

PDB Compounds: (A:) Scaffoldin C

SCOPe Domain Sequences for d5lxva_:

Sequence; same for both SEQRES and ATOM records:

>d5lxva_ b.2.2.0 (A:) automated matches {Ruminococcus flavefaciens [TaxId: 641112]}
etvqisasnaeakagdqfevkvsladvpstgiqgidfavtydntvvtidkitvgeiadtk
aassdqtasllptfdvsiqnsegyssviwstavedssywiskdgvlctitgtvssnakpg
aespikleavkretyvgsgtdnssisagysandkavkytvkatngkisvpsa

Timeline for d5lxva_:

• d5lxva_ first appeared in SCOPe 2.06
  
• d5lxva_ appears in SCOPe 2.07