Lineage for d5tkwa2 (5tkw A:151-237)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885276Species Klebsiella pneumoniae [TaxId:484021] [324280] (1 PDB entry)
  8. 2885278Domain d5tkwa2: 5tkw A:151-237 [324282]
    automated match to d4phtx2
    complexed with fmt

Details for d5tkwa2

PDB Entry: 5tkw (more details), 1.35 Å

PDB Description: 1.35 angstrom resolution crystal structure of a pullulanase-specific type ii secretion system integral cytoplasmic membrane protein gspl (n-terminal fragment; residues 1-237) from klebsiella pneumoniae.
PDB Compounds: (A:) type II secretion system protein l

SCOPe Domain Sequences for d5tkwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tkwa2 c.55.1.0 (A:151-237) automated matches {Klebsiella pneumoniae [TaxId: 484021]}
ppawsavqvdeqwlirhqpwggmaaenvwltellqseaeehvidsyspppaapgvwreqp
aqtlltlaarhpaaqklsllqgefavr

SCOPe Domain Coordinates for d5tkwa2:

Click to download the PDB-style file with coordinates for d5tkwa2.
(The format of our PDB-style files is described here.)

Timeline for d5tkwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5tkwa1