SCOPe 2.08: Domain d5tkwa2: 5tkw A:151-237

Lineage for d5tkwa2 (5tkw A:151-237)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:484021] [324280] (1 PDB entry)

8. Domain d5tkwa2: 5tkw A:151-237 [324282]
   automated match to d4phtx2
   complexed with fmt

Details for d5tkwa2

PDB Entry: 5tkw, 1.35 Å

PDB Description: 1.35 angstrom resolution crystal structure of a pullulanase-specific type ii secretion system integral cytoplasmic membrane protein gspl (n-terminal fragment; residues 1-237) from klebsiella pneumoniae.

PDB Compounds: (A:) type II secretion system protein l

SCOPe Domain Sequences for d5tkwa2:

Sequence; same for both SEQRES and ATOM records:

>d5tkwa2 c.55.1.0 (A:151-237) automated matches {Klebsiella pneumoniae [TaxId: 484021]}
ppawsavqvdeqwlirhqpwggmaaenvwltellqseaeehvidsyspppaapgvwreqp
aqtlltlaarhpaaqklsllqgefavr

Timeline for d5tkwa2:

• d5tkwa2 first appeared in SCOPe 2.06
  
• d5tkwa2 appears in SCOPe 2.07