Lineage for d5sv3a_ (5sv3 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (147 PDB entries)
  8. 2347903Domain d5sv3a_: 5sv3 A: [324273]
    automated match to d4y5vd_
    complexed with so4

Details for d5sv3a_

PDB Entry: 5sv3 (more details), 2.73 Å

PDB Description: rta1-33/44-198 (rvec) bound to single domain antibody a3c8
PDB Compounds: (A:) Anti-Ricin A-chain Single Domain Antibody (sdAb) A3C8

SCOPe Domain Sequences for d5sv3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5sv3a_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
evqlvesggglvqagdslrlsctasgrtlgdygvawfrqapgkerefvsvisrstiitdy
adsvrgrfsisadsakntvylqmnslkpedtavyycavianpvyatsrnsddyghwgqgt
qvtvss

SCOPe Domain Coordinates for d5sv3a_:

Click to download the PDB-style file with coordinates for d5sv3a_.
(The format of our PDB-style files is described here.)

Timeline for d5sv3a_: