Lineage for d5k4za_ (5k4z A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2415584Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2415631Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2415632Protein automated matches [227084] (14 species)
    not a true protein
  7. 2415840Species Mycobacterium thermoresistibile [TaxId:1797] [324226] (2 PDB entries)
  8. 2415842Domain d5k4za_: 5k4z A: [324272]
    automated match to d4zqra_
    complexed with 6q8, imp

Details for d5k4za_

PDB Entry: 5k4z (more details), 1.64 Å

PDB Description: m. thermoresistible impdh in complex with imp and compound 6
PDB Compounds: (A:) Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d5k4za_:

Sequence, based on SEQRES records: (download)

>d5k4za_ c.1.5.0 (A:) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
vptggddptkiamlgltfddvlllpaasdvlpanadtssqltkkirlkvplvssamdtvt
earmaiamaraggmgvlhrnlpvaeqaaqvetvkrsggllvgaavgvgddaweramalrd
agvdvlvvdtahahnrkvldmvhrlkttvgdeievvggnvatraaaaalveagadavkvg
vgpgsicttrvvagvgapqitaileavaacaphgvpviadgglqysgdiakalaagasta
mlgsllagtaespgelilvngkqfksyrgmgslgamqgrggaksyskdryfqddalsedk
lvpegiegrvpfrgplstvihqlvgglraamgytgsatieelqqaqfvqitaagl

Sequence, based on observed residues (ATOM records): (download)

>d5k4za_ c.1.5.0 (A:) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
vptggddptkiamlgltfddvlllpaasdvlpanadtssqltkkirlkvplvssamdtvt
earmaiamaraggmgvlhrnlpvaeqaaqvetvkrsggllvgaavgvgddaweramalrd
agvdvlvvdtahahnrkvldmvhrlkttvgdeievvggnvatraaaaalveagadavkvg
vgpgsicttrvvagvgapqitaileavaacaphgvpviadgglqysgdiakalaagasta
mlgsllagtaespgelilvngkqfksyrgmgslgamqlvpegiegrvpfrgplstvihql
vgglraamgytgsatieelqqaqfvqitaagl

SCOPe Domain Coordinates for d5k4za_:

Click to download the PDB-style file with coordinates for d5k4za_.
(The format of our PDB-style files is described here.)

Timeline for d5k4za_: