SCOPe 2.08: Domain d5g2da1: 5g2d A:1-265

Lineage for d5g2da1 (5g2d A:1-265)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.0: automated matches [227143] (1 protein)
   not a true family

6. Protein automated matches [226845] (25 species)
   not a true protein

7. Species Nonlabens marinus [TaxId:1454201] [319523] (32 PDB entries)

8. Domain d5g2da1: 5g2d A:1-265 [324271]
   Other proteins in same PDB: d5g2da2
   automated match to d5azdc_
   complexed with cl, ola, peg, ret; mutant

Details for d5g2da1

PDB Entry: 5g2d, 1.8 Å

PDB Description: the crystal structure of light-driven chloride pump clr (t102n) mutant at ph 4.5.

PDB Compounds: (A:) chloride pump rhodopsin

SCOPe Domain Sequences for d5g2da1:

Sequence; same for both SEQRES and ATOM records:

>d5g2da1 f.13.1.0 (A:1-265) automated matches {Nonlabens marinus [TaxId: 1454201]}
mknieslfdysagqfefidhlltmgvgvhfaalifflvvsqfvapkyriatalscivmvs
aglilnsqavmwtdayayvdgsyqlqdltfsngyryvnwmanipclllqllivlnlkgke
lfstatwlilaawgmiitgyvgqlyevddiaqlmiwgavstaffvvmnwivgtkifknra
tmlggtdstitkvfwlmmfawtlypiaylvpafmnnadgvvlrqllftiadisskviygl
mityiaiqqsaaagyvpaqqalgri

Timeline for d5g2da1:

• d5g2da1 first appeared in SCOPe 2.06
  
• d5g2da1 appears in SCOPe 2.07