![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
![]() | Protein CDC6, N-domain [52715] (1 species) contains "winged helix" DNA-binding domain after the family specific domains |
![]() | Species Pyrobaculum aerophilum [TaxId:13773] [52716] (1 PDB entry) |
![]() | Domain d1fnnb2: 1fnn B:1-276 [32427] Other proteins in same PDB: d1fnna1, d1fnnb1 complexed with adp, mg |
PDB Entry: 1fnn (more details), 2 Å
SCOPe Domain Sequences for d1fnnb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnnb2 c.37.1.20 (B:1-276) CDC6, N-domain {Pyrobaculum aerophilum [TaxId: 13773]} aivvddsvfspsyvpkrlphreqqlqqldillgnwlrnpghhypratllgrpgtgktvtl rklwelykdkttarfvyingfiyrnftaiigeiarslnipfprrglsrdeflallvehlr erdlymflvlddafnlapdilstfirlgqeadklgafrialvivghndavlnnldpstrg imgkyvirfspytkdqifdilldrakaglaegsysedilqmiaditgaqtpldtnrgdar laidilyrsayaaqqngrkhiapedvrksskevlfg
Timeline for d1fnnb2: