SCOP 1.59: Domain d1fnnb2: 1fnn B:1-276

Lineage for d1fnnb2 (1fnn B:1-276)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families)

5. Family c.37.1.13: Extended AAA-ATPase domain [52700] (16 proteins)

6. Protein CDC6, N-domain [52715] (1 species)

7. Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [52716] (1 PDB entry)

8. Domain d1fnnb2: 1fnn B:1-276 [32427]
   Other proteins in same PDB: d1fnna1, d1fnnb1

Details for d1fnnb2

PDB Entry: 1fnn, 2 Å

PDB Description: crystal structure of cdc6p from pyrobaculum aerophilum

SCOP Domain Sequences for d1fnnb2:

Sequence; same for both SEQRES and ATOM records:

>d1fnnb2 c.37.1.13 (B:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum}
aivvddsvfspsyvpkrlphreqqlqqldillgnwlrnpghhypratllgrpgtgktvtl
rklwelykdkttarfvyingfiyrnftaiigeiarslnipfprrglsrdeflallvehlr
erdlymflvlddafnlapdilstfirlgqeadklgafrialvivghndavlnnldpstrg
imgkyvirfspytkdqifdilldrakaglaegsysedilqmiaditgaqtpldtnrgdar
laidilyrsayaaqqngrkhiapedvrksskevlfg

Timeline for d1fnnb2:

• d1fnnb2 first appeared (with stable ids) in SCOP 1.55
  
• d1fnnb2 appears in SCOP 1.57
  
• d1fnnb2 appears in SCOP 1.61
  
• d1fnnb2 appears in the current release, SCOPe 2.08