Lineage for d1fnnb2 (1fnn B:1-276)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 70260Family c.37.1.13: Extended AAA-ATPase domain [52700] (15 proteins)
  6. 70264Protein CDC6, N-domain [52715] (1 species)
  7. 70265Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [52716] (1 PDB entry)
  8. 70267Domain d1fnnb2: 1fnn B:1-276 [32427]
    Other proteins in same PDB: d1fnna1, d1fnnb1

Details for d1fnnb2

PDB Entry: 1fnn (more details), 2 Å

PDB Description: crystal structure of cdc6p from pyrobaculum aerophilum

SCOP Domain Sequences for d1fnnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnnb2 c.37.1.13 (B:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum}
aivvddsvfspsyvpkrlphreqqlqqldillgnwlrnpghhypratllgrpgtgktvtl
rklwelykdkttarfvyingfiyrnftaiigeiarslnipfprrglsrdeflallvehlr
erdlymflvlddafnlapdilstfirlgqeadklgafrialvivghndavlnnldpstrg
imgkyvirfspytkdqifdilldrakaglaegsysedilqmiaditgaqtpldtnrgdar
laidilyrsayaaqqngrkhiapedvrksskevlfg

SCOP Domain Coordinates for d1fnnb2:

Click to download the PDB-style file with coordinates for d1fnnb2.
(The format of our PDB-style files is described here.)

Timeline for d1fnnb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fnnb1