![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
![]() | Family b.2.2.0: automated matches [191610] (1 protein) not a true family |
![]() | Protein automated matches [191113] (13 species) not a true protein |
![]() | Species Ruminococcus flavefaciens [TaxId:641112] [324254] (1 PDB entry) |
![]() | Domain d5lxvc_: 5lxv C: [324255] automated match to d3ul4a_ complexed with ca |
PDB Entry: 5lxv (more details), 2.4 Å
SCOPe Domain Sequences for d5lxvc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lxvc_ b.2.2.0 (C:) automated matches {Ruminococcus flavefaciens [TaxId: 641112]} agetvqisasnaeakagdqfevkvsladvpstgiqgidfavtydntvvtidkitvgeiad tkaassdqtasllptfdvsiqnsegyssviwstavedssywiskdgvlctitgtvssnak pgaespikleavkretyvgsgtdnssisagysandkavkytvkatngkisvps
Timeline for d5lxvc_: