SCOPe 2.08: Domain d5hgpa2: 5hgp A:148-219

Lineage for d5hgpa2 (5hgp A:148-219)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (12 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [324248] (1 PDB entry)

8. Domain d5hgpa2: 5hgp A:148-219 [324249]
   Other proteins in same PDB: d5hgpa1
   automated match to d2m8pa2
   complexed with bhc

Details for d5hgpa2

PDB Entry: 5hgp, 1.95 Å

PDB Description: hexameric hiv-1 ca in complex with hexacarboxybenzene

PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d5hgpa2:

Sequence, based on SEQRES records:

>d5hgpa2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq

Sequence, based on observed residues (ATOM records):

>d5hgpa2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqtllvqnanpdcktilkalgpgatleemmtac
q

Timeline for d5hgpa2:

• d5hgpa2 first appeared in SCOPe 2.06
  
• d5hgpa2 appears in SCOPe 2.07