SCOPe 2.06: Domain d5llda2: 5lld A:250-400

Lineage for d5llda2 (5lld A:250-400)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (24 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [259351] (4 PDB entries)

8. Domain d5llda2: 5lld A:250-400 [324246]
   Other proteins in same PDB: d5llda1
   automated match to d4d02a2
   complexed with fe, fmn, oxy

Details for d5llda2

PDB Entry: 5lld, 2.65 Å

PDB Description: flavodiiron core of escherichia coli flavorubredoxin in the reduced form.

PDB Compounds: (A:) anaerobic nitric oxide reductase flavorubredoxin

SCOPe Domain Sequences for d5llda2:

Sequence; same for both SEQRES and ATOM records:

>d5llda2 c.23.5.0 (A:250-400) automated matches {Escherichia coli [TaxId: 83333]}
qedritifydtmsnntrmmadaiaqgiaetdprvavkifnvarsdkneiltnvfrskgvl
vgtstmnnvmmpkiaglveemtglrfrnkrasafgshgwsggavdrlstrlqdagfemsl
slkakwrpdqdalklcrehgreiarqwalap

Timeline for d5llda2:

• d5llda2 is new in SCOPe 2.06-stable
  
• d5llda2 appears in SCOPe 2.07
  
• d5llda2 appears in the current release, SCOPe 2.08