Lineage for d5llda2 (5lld A:250-400)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439108Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2439628Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2439629Protein automated matches [190158] (28 species)
    not a true protein
  7. 2439690Species Escherichia coli [TaxId:83333] [259351] (4 PDB entries)
  8. 2439692Domain d5llda2: 5lld A:250-400 [324246]
    Other proteins in same PDB: d5llda1
    automated match to d4d02a2
    complexed with fe, fmn, oxy

Details for d5llda2

PDB Entry: 5lld (more details), 2.65 Å

PDB Description: flavodiiron core of escherichia coli flavorubredoxin in the reduced form.
PDB Compounds: (A:) anaerobic nitric oxide reductase flavorubredoxin

SCOPe Domain Sequences for d5llda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5llda2 c.23.5.0 (A:250-400) automated matches {Escherichia coli [TaxId: 83333]}
qedritifydtmsnntrmmadaiaqgiaetdprvavkifnvarsdkneiltnvfrskgvl
vgtstmnnvmmpkiaglveemtglrfrnkrasafgshgwsggavdrlstrlqdagfemsl
slkakwrpdqdalklcrehgreiarqwalap

SCOPe Domain Coordinates for d5llda2:

Click to download the PDB-style file with coordinates for d5llda2.
(The format of our PDB-style files is described here.)

Timeline for d5llda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5llda1