Lineage for d5llda1 (5lld A:3-249)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231713Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2231714Protein automated matches [190418] (18 species)
    not a true protein
  7. 2231743Species Escherichia coli [TaxId:83333] [259349] (3 PDB entries)
  8. 2231747Domain d5llda1: 5lld A:3-249 [324245]
    Other proteins in same PDB: d5llda2
    automated match to d4d02a1
    complexed with fe, fmn, oxy

Details for d5llda1

PDB Entry: 5lld (more details), 2.65 Å

PDB Description: flavodiiron core of escherichia coli flavorubredoxin in the reduced form.
PDB Compounds: (A:) anaerobic nitric oxide reductase flavorubredoxin

SCOPe Domain Sequences for d5llda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5llda1 d.157.1.0 (A:3-249) automated matches {Escherichia coli [TaxId: 83333]}
ivvknnihwvgqrdwevrdfhgteyktlrgssynsylireeknvlidtvdhkfsrefvqn
lrneidladidyivinhaeedhagaltelmaqipdtpiyctanaidsinghhhhpewnfn
vvktgdtldigngkqlifvetpmlhwpdsmmtyltgdavlfsndafgqhycdehlfndev
dqtelfeqcqryyaniltpfsrlvtpkiteilgfnlpvdmiatshgvvwrdnptqively
lkwaady

SCOPe Domain Coordinates for d5llda1:

Click to download the PDB-style file with coordinates for d5llda1.
(The format of our PDB-style files is described here.)

Timeline for d5llda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5llda2