Lineage for d5f8ve_ (5f8v E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2898159Species Trichomonas vaginalis [TaxId:5722] [324159] (1 PDB entry)
  8. 2898164Domain d5f8ve_: 5f8v E: [324244]
    automated match to d2c0ra_

Details for d5f8ve_

PDB Entry: 5f8v (more details), 2.14 Å

PDB Description: crystal structure of plp bound phosphoserine aminotransferase (psat) from trichomonas vaginalis
PDB Compounds: (E:) Aminotransferase, class V family protein

SCOPe Domain Sequences for d5f8ve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f8ve_ c.67.1.0 (E:) automated matches {Trichomonas vaginalis [TaxId: 5722]}
raynfsagpaavplecleraaaemtnwrnsgmsvievshrgkhwmeeqkeaterlrtllq
vpenfnilfvaggaslqfsaipfnfigehkavdylctgtwskkafdeckrlafpgvtvns
vagnppanpvevpardtwklsedaayfyycdnetiqgiefqqfpdvpapliidmssnfls
rpitqwekvgcifacaqknfglagmsvviirkdmlerpvkpfcpitmdyriqvknncmyn
tpptfaiyfanhifkwieekgglaamdalnkekakkvyeaidsnpnfvnrikpewrsrmn
mpffrpdgyenkdldadakfvnfctqrklltlkghvsvggfrascynacpmeavdalvqa
mkew

SCOPe Domain Coordinates for d5f8ve_:

Click to download the PDB-style file with coordinates for d5f8ve_.
(The format of our PDB-style files is described here.)

Timeline for d5f8ve_: