SCOPe 2.07: Domain d5azic1: 5azi C:1-262

Lineage for d5azic1 (5azi C:1-262)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (63 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:31285] [268052] (13 PDB entries)

8. Domain d5azic1: 5azi C:1-262 [324240]
   Other proteins in same PDB: d5azia3, d5azib3, d5azic3, d5azid3
   automated match to d3wxla1
   complexed with 4np, gol

Details for d5azic1

PDB Entry: 5azi, 2.45 Å

PDB Description: crystal structure of glycerol kinase from trypanosoma brucei gambiense complexed with 4np

PDB Compounds: (C:) glycerol kinase

SCOPe Domain Sequences for d5azic1:

Sequence; same for both SEQRES and ATOM records:

>d5azic1 c.55.1.0 (C:1-262) automated matches {Trypanosoma brucei [TaxId: 31285]}
mkyvgsidqgttstrfiifderqrpvsvhqvphtqhtphpgwlehdpmeifrsackcmsv
aiaklrqkdasfrkieaigitnqrettvawdrvtkeplcyapvwndlrtyditkkvtael
gggdsmfaskitglpvstyfaafkmrwmlenvpavadacrrgtlcfgtidtwlmyklsgg
kafvtdvtnasrtflmdlrtrkwspelceklkipmetlpeirsnselfgyvetdecgvaa
alnertpimgsigdqqsalfgn

Timeline for d5azic1:

• d5azic1 first appeared in SCOPe 2.06
  
• d5azic1 appears in the current release, SCOPe 2.08