SCOP 1.71: Domain d1hqca2: 1hqc A:5-242

Lineage for d1hqca2 (1hqc A:5-242)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (26 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein Holliday junction helicase RuvB [52713] (2 species)
   contains "winged helix" DNA-binding domain after the family specific domains

7. Species Thermus thermophilus [TaxId:274] [52714] (3 PDB entries)

8. Domain d1hqca2: 1hqc A:5-242 [32424]
   Other proteins in same PDB: d1hqca1, d1hqcb1

Details for d1hqca2

PDB Entry: 1hqc, 3.2 Å

PDB Description: structure of ruvb from thermus thermophilus hb8

SCOP Domain Sequences for d1hqca2:

Sequence; same for both SEQRES and ATOM records:

>d1hqca2 c.37.1.20 (A:5-242) Holliday junction helicase RuvB {Thermus thermophilus}
alrpktldeyigqerlkqklrvyleaakarkeplehlllfgppglgkttlahviahelgv
nlrvtsgpaiekpgdlaailansleegdilfideihrlsrqaeehlypamedfvmdivig
qgpaartirlelprftligattrpglitapllsrfgivehleyytpeelaqgvmrdarll
gvriteeaaleigrrsrgtmrvakrlfrrvrdfaqvageevitreralealaalglde

Timeline for d1hqca2:

• d1hqca2 first appeared (with stable ids) in SCOP 1.55
  
• d1hqca2 appears in SCOP 1.69
  
• d1hqca2 appears in SCOP 1.73
  
• d1hqca2 appears in the current release, SCOPe 2.08