Lineage for d1hqca2 (1hqc A:5-242)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 122576Family c.37.1.13: Extended AAA-ATPase domain [52700] (16 proteins)
  6. 122625Protein Holliday junction helicase RuvB [52713] (2 species)
  7. 122633Species Thermus thermophilus [TaxId:274] [52714] (1 PDB entry)
  8. 122634Domain d1hqca2: 1hqc A:5-242 [32424]
    Other proteins in same PDB: d1hqca1, d1hqcb1

Details for d1hqca2

PDB Entry: 1hqc (more details), 3.2 Å

PDB Description: structure of ruvb from thermus thermophilus hb8

SCOP Domain Sequences for d1hqca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqca2 c.37.1.13 (A:5-242) Holliday junction helicase RuvB {Thermus thermophilus}
alrpktldeyigqerlkqklrvyleaakarkeplehlllfgppglgkttlahviahelgv
nlrvtsgpaiekpgdlaailansleegdilfideihrlsrqaeehlypamedfvmdivig
qgpaartirlelprftligattrpglitapllsrfgivehleyytpeelaqgvmrdarll
gvriteeaaleigrrsrgtmrvakrlfrrvrdfaqvageevitreralealaalglde

SCOP Domain Coordinates for d1hqca2:

Click to download the PDB-style file with coordinates for d1hqca2.
(The format of our PDB-style files is described here.)

Timeline for d1hqca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hqca1