SCOPe 2.06: Domain d5khod_: 5kho D:

Lineage for d5khod_ (5kho D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (179 PDB entries)

8. Domain d5khod_: 5kho D: [324233]
   automated match to d4hdob_
   complexed with gnp, gol, mg

Details for d5khod_

PDB Entry: 5kho, 2.78 Å

PDB Description: rasip1 ra domain in complex with rap1b

PDB Compounds: (D:) Ras-related protein Rap-1b

SCOPe Domain Sequences for d5khod_:

Sequence; same for both SEQRES and ATOM records:

>d5khod_ c.37.1.8 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr

Timeline for d5khod_:

• d5khod_ is new in SCOPe 2.06-stable
  
• d5khod_ appears in SCOPe 2.07
  
• d5khod_ appears in the current release, SCOPe 2.08