SCOPe 2.07: Domain d5gvsc_: 5gvs C:

Lineage for d5gvsc_ (5gvs C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (202 PDB entries)

8. Domain d5gvsc_: 5gvs C: [324232]
   automated match to d2g9nb_

Details for d5gvsc_

PDB Entry: 5gvs, 2.2 Å

PDB Description: crystal structure of the ddx41 dead domain in an apo open form

PDB Compounds: (C:) Probable ATP-dependent RNA helicase DDX41

SCOPe Domain Sequences for d5gvsc_:

Sequence, based on SEQRES records:

>d5gvsc_ c.37.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ailrglkkkgihhptpiqiqgiptilsgrdmigiaftgsgktlvftlpvimfcleqekrl
pfskregpygliicpsrelarqthgileyycrllqedsspllrcalciggmsvkeqmeti
rhgvhmmvatpgrlmdllqkkmvsldicrylaldeadrmidmgfegdirtifsyfkgqrq
tllfsatmpkkiqnfaksalvkpvtinvg

Sequence, based on observed residues (ATOM records):

>d5gvsc_ c.37.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ailrglkkkgiptilsgrdmigiaftgsgktlvftlpvimfcleqekrlpfskregpygl
iicpsrelarqthgileyycrllqedsspllrcalciggmsvkeqmetirhgvhmmvatp
grlmdllqkkmvsldicrylaldeadrmidmgfegdirtifsyfkgqrqtllfsatmpkk
iqnfaksalvkpvtinvg

Timeline for d5gvsc_:

• d5gvsc_ first appeared in SCOPe 2.06
  
• d5gvsc_ appears in the current release, SCOPe 2.08