Lineage for d1a5ta2 (1a5t A:1-207)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479032Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2479111Protein delta prime subunit of DNA polymerase III, N-domain [52711] (1 species)
    contains additional alpha-helical domain after the family specific domains
  7. 2479112Species Escherichia coli [TaxId:562] [52712] (6 PDB entries)
    Uniprot P28631
  8. 2479113Domain d1a5ta2: 1a5t A:1-207 [32423]
    Other proteins in same PDB: d1a5ta1
    protein/DNA complex; complexed with zn

Details for d1a5ta2

PDB Entry: 1a5t (more details), 2.2 Å

PDB Description: crystal structure of the delta prime subunit of the clamp-loader complex of escherichia coli dna polymerase iii
PDB Compounds: (A:) delta prime

SCOPe Domain Sequences for d1a5ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}
mrwypwlrpdfeklvasyqagrghhalliqalpgmgddaliyalsryllcqqpqghkscg
hcrgcqlmqagthpdyytlapekgkntlgvdavrevteklneharlggakvvwvtdaall
tdaaanallktleeppaetwfflatreperllatlrsrcrlhylapppeqyavtwlsrev
tmsqdallaalrlsagspgaalalfqg

SCOPe Domain Coordinates for d1a5ta2:

Click to download the PDB-style file with coordinates for d1a5ta2.
(The format of our PDB-style files is described here.)

Timeline for d1a5ta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a5ta1