Lineage for d1a5t_2 (1a5t 1-207)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 122576Family c.37.1.13: Extended AAA-ATPase domain [52700] (16 proteins)
  6. 122584Protein delta prime subunit of DNA polymerase III, N-domain [52711] (1 species)
  7. 122585Species Escherichia coli [TaxId:562] [52712] (2 PDB entries)
  8. 122586Domain d1a5t_2: 1a5t 1-207 [32423]
    Other proteins in same PDB: d1a5t_1

Details for d1a5t_2

PDB Entry: 1a5t (more details), 2.2 Å

PDB Description: crystal structure of the delta prime subunit of the clamp-loader complex of escherichia coli dna polymerase iii
PDB Compounds: ( :)

SCOP Domain Sequences for d1a5t_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5t_2 c.37.1.13 (1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli}
mrwypwlrpdfeklvasyqagrghhalliqalpgmgddaliyalsryllcqqpqghkscg
hcrgcqlmqagthpdyytlapekgkntlgvdavrevteklneharlggakvvwvtdaall
tdaaanallktleeppaetwfflatreperllatlrsrcrlhylapppeqyavtwlsrev
tmsqdallaalrlsagspgaalalfqg

SCOP Domain Coordinates for d1a5t_2:

Click to download the PDB-style file with coordinates for d1a5t_2.
(The format of our PDB-style files is described here.)

Timeline for d1a5t_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a5t_1