Lineage for d1a5t_2 (1a5t 1-207)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) 
Family c.37.1.13: Extended AAA-ATPase domain [52700] (15 proteins) 
Protein delta prime subunit of DNA polymerase III, N-domain [52711] (1 species) Species Escherichia coli [TaxId:562] [52712] (2 PDB entries) 
Domain d1a5t_2: 1a5t 1-207 [32423]
Other proteins in same PDB: d1a5t_1
Details for d1a5t_2
PDB Entry: 1a5t (more details), 2.2 Å
PDB Description: crystal structure of the delta prime subunit of the clamp-loader complex of escherichia coli dna polymerase iii
SCOP Domain Sequences for d1a5t_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a5t_2 c.37.1.13 (1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli}
mrwypwlrpdfeklvasyqagrghhalliqalpgmgddaliyalsryllcqqpqghkscg
hcrgcqlmqagthpdyytlapekgkntlgvdavrevteklneharlggakvvwvtdaall
tdaaanallktleeppaetwfflatreperllatlrsrcrlhylapppeqyavtwlsrev
tmsqdallaalrlsagspgaalalfqg
SCOP Domain Coordinates for d1a5t_2:
Click to download the PDB-style file with coordinates for d1a5t_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a5t_2:
- d1a5t_2 first appeared (with stable ids) in SCOP 1.55
- d1a5t_2 appears in SCOP 1.59
- d1a5t_2 appears in the current release, SCOPe 2.08, called d1a5ta2
View in 3D
