SCOPe 2.06: Domain d5jzeb_: 5jze B:

Lineage for d5jzeb_ (5jze B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (78 PDB entries)

8. Domain d5jzeb_: 5jze B: [324224]
   automated match to d3phxb_
   complexed with aye, flc

Details for d5jzeb_

PDB Entry: 5jze, 2.47 Å

PDB Description: erve virus viral otu domain protease in complex with mouse isg15

PDB Compounds: (B:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d5jzeb_:

Sequence; same for both SEQRES and ATOM records:

>d5jzeb_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqfwlsfegrpmedkellgey
glkpqctvikhlrlrg

Timeline for d5jzeb_:

• d5jzeb_ is new in SCOPe 2.06-stable
  
• d5jzeb_ appears in SCOPe 2.07
  
• d5jzeb_ appears in the current release, SCOPe 2.08