![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.19: Tandem AAA-ATPase domain [81268] (6 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
![]() | Protein Nucleotide excision repair enzyme UvrB [52708] (2 species) contains large insertions in the first AAA domain |
![]() | Species Bacillus caldotenax [TaxId:1395] [52710] (2 PDB entries) |
![]() | Domain d1d9za2: 1d9z A:415-595 [32422] complexed with atp, mg, zn |
PDB Entry: 1d9z (more details), 3.15 Å
SCOP Domain Sequences for d1d9za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d9za2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax} tglldptidvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvay lhseiktlerieiirdlrlgkydvlvginllregldipevslvaildadkegflrsersl iqtigraarnanghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeird v
Timeline for d1d9za2: