Lineage for d1d9za2 (1d9z A:415-595)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) 
Family c.37.1.13: Extended AAA-ATPase domain [52700] (17 proteins) Protein Nucleotide excision repair enzyme UvrB [52708] (2 species) 
Species Bacillus caldotenax [TaxId:1395] [52710] (2 PDB entries) 
Domain d1d9za2: 1d9z A:415-595 [32422]
Details for d1d9za2
PDB Entry: 1d9z (more details), 3.15 Å
PDB Description: crystal structure of the dna repair protein uvrb in complex with atp
SCOP Domain Sequences for d1d9za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d9za2 c.37.1.13 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax}
tglldptidvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvay
lhseiktlerieiirdlrlgkydvlvginllregldipevslvaildadkegflrsersl
iqtigraarnanghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeird
v
SCOP Domain Coordinates for d1d9za2:
Click to download the PDB-style file with coordinates for d1d9za2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d9za2:
- d1d9za2 first appeared (with stable ids) in SCOP 1.55
- d1d9za2 appears in SCOP 1.59
- d1d9za2 appears in SCOP 1.63
- d1d9za2 appears in the current release, SCOPe 2.08
View in 3D
