Lineage for d1d9za2 (1d9z A:415-595)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 70260Family c.37.1.13: Extended AAA-ATPase domain [52700] (15 proteins)
  6. 70364Protein Nucleotide excision repair enzyme UvrB [52708] (2 species)
  7. 70365Species Bacillus caldotenax [TaxId:1395] [52710] (2 PDB entries)
  8. 70369Domain d1d9za2: 1d9z A:415-595 [32422]

Details for d1d9za2

PDB Entry: 1d9z (more details), 3.15 Å

PDB Description: crystal structure of the dna repair protein uvrb in complex with atp

SCOP Domain Sequences for d1d9za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d9za2 c.37.1.13 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax}
tglldptidvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvay
lhseiktlerieiirdlrlgkydvlvginllregldipevslvaildadkegflrsersl
iqtigraarnanghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeird
v

SCOP Domain Coordinates for d1d9za2:

Click to download the PDB-style file with coordinates for d1d9za2.
(The format of our PDB-style files is described here.)

Timeline for d1d9za2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d9za1