Lineage for d1d9za2 (1d9z A:415-595)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. Protein Nucleotide excision repair enzyme UvrB, C-terminal domain [418969] (2 species)
  7. Species Bacillus caldotenax [TaxId:1395] [419431] (4 PDB entries)
    Uniprot P56981
  8. 2870768Domain d1d9za2: 1d9z A:415-595 [32422]
    Other proteins in same PDB: d1d9za1
    protein/DNA complex; complexed with atp, mg, zn

Details for d1d9za2

PDB Entry: 1d9z (more details), 3.15 Å

PDB Description: crystal structure of the dna repair protein uvrb in complex with atp
PDB Compounds: (A:) excinuclease uvrabc component uvrb

SCOPe Domain Sequences for d1d9za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d9za2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB, C-terminal domain {Bacillus caldotenax [TaxId: 1395]}
tglldptidvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvay
lhseiktlerieiirdlrlgkydvlvginllregldipevslvaildadkegflrsersl
iqtigraarnanghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeird
v

SCOPe Domain Coordinates for d1d9za2:

Click to download the PDB-style file with coordinates for d1d9za2.
(The format of our PDB-style files is described here.)

Timeline for d1d9za2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d9za1