Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
Domain d1d9za2: 1d9z A:415-595 [32422] Other proteins in same PDB: d1d9za1 protein/DNA complex; complexed with atp, mg, zn |
PDB Entry: 1d9z (more details), 3.15 Å
SCOPe Domain Sequences for d1d9za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d9za2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB, C-terminal domain {Bacillus caldotenax [TaxId: 1395]} tglldptidvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvay lhseiktlerieiirdlrlgkydvlvginllregldipevslvaildadkegflrsersl iqtigraarnanghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeird v
Timeline for d1d9za2: