Lineage for d5g1sc_ (5g1s C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2852295Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2852608Protein automated matches [190149] (14 species)
    not a true protein
  7. 2852829Species Francisella tularensis [TaxId:263] [324166] (3 PDB entries)
  8. 2852832Domain d5g1sc_: 5g1s C: [324210]
    automated match to d3p2la_
    complexed with act, mpd, mrd

Details for d5g1sc_

PDB Entry: 5g1s (more details), 1.7 Å

PDB Description: open conformation of francisella tularensis clpp at 1.7 a
PDB Compounds: (C:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d5g1sc_:

Sequence, based on SEQRES records: (download)

>d5g1sc_ c.14.1.1 (C:) automated matches {Francisella tularensis [TaxId: 263]}
nlvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiy
fyinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqim
ihqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeak
ayglidhviesreaiik

Sequence, based on observed residues (ATOM records): (download)

>d5g1sc_ c.14.1.1 (C:) automated matches {Francisella tularensis [TaxId: 263]}
nlvptviafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinspgg
mvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplggf
rgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhv
iesreaiik

SCOPe Domain Coordinates for d5g1sc_:

Click to download the PDB-style file with coordinates for d5g1sc_.
(The format of our PDB-style files is described here.)

Timeline for d5g1sc_: