| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.53: p53 tetramerization domain [47718] (1 superfamily) core: 4 helices; bundle |
Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) ![]() homotetramer |
| Family a.53.1.0: automated matches [259188] (1 protein) not a true family |
| Protein automated matches [259190] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [311354] (9 PDB entries) |
| Domain d5hobg_: 5hob G: [324209] Other proteins in same PDB: d5hobe2, d5hobh2 automated match to d3zy1a_ complexed with mg; mutant |
PDB Entry: 5hob (more details), 1.22 Å
SCOPe Domain Sequences for d5hobg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hobg_ a.53.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dedtyylqvrgrknfeilmelkrslelmelvpqplvdsyeqqqqllq
Timeline for d5hobg_: