![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.19: Tandem AAA-ATPase domain [81268] (27 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
![]() | Protein Nucleotide excision repair enzyme UvrB [52708] (2 species) contains large insertions in the first AAA domain |
![]() | Species Bacillus caldotenax [TaxId:1395] [52710] (4 PDB entries) Uniprot P56981 |
![]() | Domain d1d9xa2: 1d9x A:415-595 [32420] complexed with zn |
PDB Entry: 1d9x (more details), 2.6 Å
SCOPe Domain Sequences for d1d9xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d9xa2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} tglldptidvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvay lhseiktlerieiirdlrlgkydvlvginllregldipevslvaildadkegflrsersl iqtigraarnanghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeird v
Timeline for d1d9xa2: