SCOP 1.57: Domain d1d9xa2: 1d9x A:415-595

Lineage for d1d9xa2 (1d9x A:415-595)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families)

5. Family c.37.1.13: Extended AAA-ATPase domain [52700] (15 proteins)

6. Protein Nucleotide excision repair enzyme UvrB [52708] (2 species)

7. Species Bacillus caldotenax [TaxId:1395] [52710] (2 PDB entries)

8. Domain d1d9xa2: 1d9x A:415-595 [32420]

Details for d1d9xa2

PDB Entry: 1d9x, 2.6 Å

PDB Description: crystal structure of the dna repair protein uvrb

SCOP Domain Sequences for d1d9xa2:

Sequence; same for both SEQRES and ATOM records:

>d1d9xa2 c.37.1.13 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax}
tglldptidvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvay
lhseiktlerieiirdlrlgkydvlvginllregldipevslvaildadkegflrsersl
iqtigraarnanghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeird
v

Timeline for d1d9xa2:

• d1d9xa2 first appeared (with stable ids) in SCOP 1.55
  
• d1d9xa2 appears in SCOP 1.59
  
• d1d9xa2 appears in the current release, SCOPe 2.08