Lineage for d5hobh1 (5hob H:351-394)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714980Fold a.53: p53 tetramerization domain [47718] (1 superfamily)
    core: 4 helices; bundle
  4. 2714981Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) (S)
    homotetramer
  5. 2715047Family a.53.1.0: automated matches [259188] (1 protein)
    not a true family
  6. 2715048Protein automated matches [259190] (2 species)
    not a true protein
  7. 2715049Species Human (Homo sapiens) [TaxId:9606] [311354] (9 PDB entries)
  8. 2715057Domain d5hobh1: 5hob H:351-394 [324198]
    Other proteins in same PDB: d5hobe2, d5hobh2
    automated match to d3zy1a_
    complexed with mg; mutant

Details for d5hobh1

PDB Entry: 5hob (more details), 1.22 Å

PDB Description: p73 homo-tetramerization domain mutant i
PDB Compounds: (H:) Tumor protein p73

SCOPe Domain Sequences for d5hobh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hobh1 a.53.1.0 (H:351-394) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dedtyylqvrgrknfeilmelkrslelmelvpqplvdsyeqqqq

SCOPe Domain Coordinates for d5hobh1:

Click to download the PDB-style file with coordinates for d5hobh1.
(The format of our PDB-style files is described here.)

Timeline for d5hobh1: