| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.53: p53 tetramerization domain [47718] (1 superfamily) core: 4 helices; bundle |
Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) ![]() homotetramer |
| Family a.53.1.0: automated matches [259188] (1 protein) not a true family |
| Protein automated matches [259190] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [311354] (4 PDB entries) |
| Domain d5hocb_: 5hoc B: [324193] automated match to d3zy1a_ mutant |
PDB Entry: 5hoc (more details), 1.36 Å
SCOPe Domain Sequences for d5hocb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hocb_ a.53.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dedtyylqvrgrrnfeilmelkrslelmelvpqplvdsydqqqq
Timeline for d5hocb_: