Lineage for d5hs4a1 (5hs4 A:4-150)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2429095Family c.2.1.5: LDH N-terminal domain-like [51848] (9 protein domains)
  6. 2429134Protein Lactate dehydrogenase [51859] (19 species)
  7. 2429348Species Plasmodium vivax [TaxId:5855] [225043] (3 PDB entries)
  8. 2429349Domain d5hs4a1: 5hs4 A:4-150 [324190]
    Other proteins in same PDB: d5hs4a2
    automated match to d2a92a1

Details for d5hs4a1

PDB Entry: 5hs4 (more details), 1.34 Å

PDB Description: plasmdoium vivax lactate dehydrogenase
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d5hs4a1:

Sequence, based on SEQRES records: (download)

>d5hs4a1 c.2.1.5 (A:4-150) Lactate dehydrogenase {Plasmodium vivax [TaxId: 5855]}
kpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckvtg
snsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnafii
vvtnpvdvmvqllfehsgvpknkiigl

Sequence, based on observed residues (ATOM records): (download)

>d5hs4a1 c.2.1.5 (A:4-150) Lactate dehydrogenase {Plasmodium vivax [TaxId: 5855]}
kpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckvtg
snsyddlkgadvvivtagfrddllplnnkimieigghiknlcpnafiivvtnpvdvmvql
lfehsgvpknkiigl

SCOPe Domain Coordinates for d5hs4a1:

Click to download the PDB-style file with coordinates for d5hs4a1.
(The format of our PDB-style files is described here.)

Timeline for d5hs4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5hs4a2