![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.53: p53 tetramerization domain [47718] (1 superfamily) core: 4 helices; bundle |
![]() | Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) ![]() homotetramer |
![]() | Family a.53.1.0: automated matches [259188] (1 protein) not a true family |
![]() | Protein automated matches [259190] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [311354] (9 PDB entries) |
![]() | Domain d5hobe1: 5hob E:351-396 [324187] Other proteins in same PDB: d5hobe2, d5hobh2 automated match to d3zy1a_ complexed with mg; mutant |
PDB Entry: 5hob (more details), 1.22 Å
SCOPe Domain Sequences for d5hobe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hobe1 a.53.1.0 (E:351-396) automated matches {Human (Homo sapiens) [TaxId: 9606]} dedtyylqvrgrknfeilmelkrslelmelvpqplvdsyeqqqqll
Timeline for d5hobe1: