Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (22 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
Protein Nucleotide excision repair enzyme UvrB [52708] (2 species) contains large insertions in the first AAA domain |
Species Thermus thermophilus [TaxId:274] [52709] (2 PDB entries) |
Domain d1d2ma2: 1d2m A:410-583 [32418] complexed with bog, so4 |
PDB Entry: 1d2m (more details), 1.9 Å
SCOP Domain Sequences for d1d2ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d2ma2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} tglldplvrvkptenqildlmegireraargertlvtvltvrmaeeltsflvehgirary lhheldafkrqalirdlrlghydclvginllregldipevslvaildadkegflrsersl iqtigraarnargevwlyadrvseamqraieetnrrralqeaynlehgitpetv
Timeline for d1d2ma2: