Lineage for d1d2ma2 (1d2m A:410-583)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 122576Family c.37.1.13: Extended AAA-ATPase domain [52700] (16 proteins)
  6. 122692Protein Nucleotide excision repair enzyme UvrB [52708] (2 species)
  7. 122698Species Thermus thermophilus [TaxId:274] [52709] (2 PDB entries)
  8. 122702Domain d1d2ma2: 1d2m A:410-583 [32418]

Details for d1d2ma2

PDB Entry: 1d2m (more details), 1.9 Å

PDB Description: uvrb protein of thermus thermophilus hb8; a nucleotide excision repair enzyme

SCOP Domain Sequences for d1d2ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2ma2 c.37.1.13 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus}
tglldplvrvkptenqildlmegireraargertlvtvltvrmaeeltsflvehgirary
lhheldafkrqalirdlrlghydclvginllregldipevslvaildadkegflrsersl
iqtigraarnargevwlyadrvseamqraieetnrrralqeaynlehgitpetv

SCOP Domain Coordinates for d1d2ma2:

Click to download the PDB-style file with coordinates for d1d2ma2.
(The format of our PDB-style files is described here.)

Timeline for d1d2ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d2ma1