![]() | Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
![]() | Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
![]() | Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) ![]() |
![]() | Family c.37.1.13: Extended AAA-ATPase domain [52700] (15 proteins) |
![]() | Protein Nucleotide excision repair enzyme UvrB [52708] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [52709] (2 PDB entries) |
![]() | Domain d1d2ma2: 1d2m A:410-583 [32418] |
PDB Entry: 1d2m (more details), 1.9 Å
SCOP Domain Sequences for d1d2ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d2ma2 c.37.1.13 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus} tglldplvrvkptenqildlmegireraargertlvtvltvrmaeeltsflvehgirary lhheldafkrqalirdlrlghydclvginllregldipevslvaildadkegflrsersl iqtigraarnargevwlyadrvseamqraieetnrrralqeaynlehgitpetv
Timeline for d1d2ma2: