Lineage for d1d2ma1 (1d2m A:2-409)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 697477Family c.37.1.19: Tandem AAA-ATPase domain [81268] (22 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 697557Protein Nucleotide excision repair enzyme UvrB [52708] (2 species)
    contains large insertions in the first AAA domain
  7. 697571Species Thermus thermophilus [TaxId:274] [52709] (2 PDB entries)
  8. 697574Domain d1d2ma1: 1d2m A:2-409 [32417]

Details for d1d2ma1

PDB Entry: 1d2m (more details), 1.9 Å

PDB Description: uvrb protein of thermus thermophilus hb8; a nucleotide excision repair enzyme
PDB Compounds: (A:) excinuclease abc subunit b

SCOP Domain Sequences for d1d2ma1:

Sequence, based on SEQRES records: (download)

>d1d2ma1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]}
tfryrgpspkgdqpkaiaglvealrdgerfvtllgatgtgktvtmakviealgrpalvla
pnkilaaqlaaefrelfpenaveyfisyydyyqpeayvpgkdlyiekdasinpeierlrh
sttrslltrrdvivvasvsaiyglgdpreyrarnlvvergkpyprevllerllelgyqrn
didlspgrfrakgevleifpayetepirvelfgdeverisqvhpvtgerlrelpgfvlfp
athylspegleeilkeiekelwervryfeergevlyaqrlkertlydlemlrvmgtcpgv
enyaryftgkapgeppytlldyfpedflvfldeshvtvpqlqgmyrgdyarkktlvdygf
rlpsaldnrplrfeeflervsqvvfvsatpgpfelahsgrvveqiirp

Sequence, based on observed residues (ATOM records): (download)

>d1d2ma1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]}
tfryrgpspkgdqpkaiaglvealrdgerfvtllgatgtgktvtmakviealgrpalvla
pnkilaaqlaaefrelfpenaveyfisyydyyqpeayvpgkdlyiekdasinpeierlrh
sttrslltrrdvivvasvsaiyglgdpreyrarnlvvrevllerllelgyqrndidlspg
rfrakgevleifpayetepirvelgfvlfpathylspegleeilkeiekelwervryfee
rgevlyaqrlkertlydlemlrvmgtcpgvenyaryftgkapgeppytlldyfpedflvf
ldeshvtvpqlqgmyrgdyarkktlvdygfrlpsaldnrplrfeeflervsqvvfvsatp
gpfelahsgrvveqiirp

SCOP Domain Coordinates for d1d2ma1:

Click to download the PDB-style file with coordinates for d1d2ma1.
(The format of our PDB-style files is described here.)

Timeline for d1d2ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d2ma2