![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Trichomonas vaginalis [TaxId:5722] [324159] (1 PDB entry) |
![]() | Domain d5f8vb_: 5f8v B: [324165] automated match to d2c0ra_ |
PDB Entry: 5f8v (more details), 2.14 Å
SCOPe Domain Sequences for d5f8vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f8vb_ c.67.1.0 (B:) automated matches {Trichomonas vaginalis [TaxId: 5722]} raynfsagpaavplecleraaaemtnwrnsgmsvievshrgkhwmeeqkeaterlrtllq vpenfnilfvaggaslqfsaipfnfigehkavdylctgtwskkafdeckrlafpgvtvns vagnppanpvevpardtwklsedaayfyycdnetiqgiefqqfpdvpapliidmssnfls rpitqwekvgcifacaqknfglagmsvviirkdmlerpvkpfcpitmdyriqvknncmyn tpptfaiyfanhifkwieekgglaamdalnkekakkvyeaidsnpnfvnrikpewrsrmn mpffrpdgyenkdldadakfvnfctqrklltlkghvsvggfrascynacpmeavdalvqa mkewpgf
Timeline for d5f8vb_: