Lineage for d1c4oa2 (1c4o A:410-583)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 122576Family c.37.1.13: Extended AAA-ATPase domain [52700] (16 proteins)
  6. 122692Protein Nucleotide excision repair enzyme UvrB [52708] (2 species)
  7. 122698Species Thermus thermophilus [TaxId:274] [52709] (2 PDB entries)
  8. 122700Domain d1c4oa2: 1c4o A:410-583 [32416]

Details for d1c4oa2

PDB Entry: 1c4o (more details), 1.5 Å

PDB Description: crystal structure of the dna nucleotide excision repair enzyme uvrb from thermus thermophilus

SCOP Domain Sequences for d1c4oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4oa2 c.37.1.13 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus}
tglldplvrvkptenqildlmegireraargertlvtvltvrmaeeltsflvehgirary
lhheldafkrqalirdlrlghydclvginllregldipevslvaildadkegflrsersl
iqtigraarnargevwlyadrvseamqraieetnrrralqeaynlehgitpetv

SCOP Domain Coordinates for d1c4oa2:

Click to download the PDB-style file with coordinates for d1c4oa2.
(The format of our PDB-style files is described here.)

Timeline for d1c4oa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c4oa1