SCOP 1.57: Domain d1c4oa2: 1c4o A:410-583

Lineage for d1c4oa2 (1c4o A:410-583)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families)

5. Family c.37.1.13: Extended AAA-ATPase domain [52700] (15 proteins)

6. Protein Nucleotide excision repair enzyme UvrB [52708] (2 species)

7. Species Thermus thermophilus [TaxId:274] [52709] (2 PDB entries)

8. Domain d1c4oa2: 1c4o A:410-583 [32416]

Details for d1c4oa2

PDB Entry: 1c4o, 1.5 Å

PDB Description: crystal structure of the dna nucleotide excision repair enzyme uvrb from thermus thermophilus

SCOP Domain Sequences for d1c4oa2:

Sequence; same for both SEQRES and ATOM records:

>d1c4oa2 c.37.1.13 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus}
tglldplvrvkptenqildlmegireraargertlvtvltvrmaeeltsflvehgirary
lhheldafkrqalirdlrlghydclvginllregldipevslvaildadkegflrsersl
iqtigraarnargevwlyadrvseamqraieetnrrralqeaynlehgitpetv

Timeline for d1c4oa2:

• d1c4oa2 first appeared (with stable ids) in SCOP 1.55
  
• d1c4oa2 appears in SCOP 1.59
  
• d1c4oa2 appears in the current release, SCOPe 2.08