SCOPe 2.06: Domain d5ea9b_: 5ea9 B:

Lineage for d5ea9b_ (5ea9 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein automated matches [190228] (18 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:353153] [324150] (2 PDB entries)

8. Domain d5ea9b_: 5ea9 B: [324155]
   automated match to d2djxa_
   complexed with 5lm, edo, fmn, gol, nco

Details for d5ea9b_

PDB Entry: 5ea9, 1.71 Å

PDB Description: crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with neq0130

PDB Compounds: (B:) Dihydroorotate dehydrogenase (fumarate)

SCOPe Domain Sequences for d5ea9b_:

Sequence; same for both SEQRES and ATOM records:

>d5ea9b_ c.1.4.1 (B:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
tleefrgrvktie

Timeline for d5ea9b_:

• d5ea9b_ is new in SCOPe 2.06-stable
  
• d5ea9b_ appears in SCOPe 2.07
  
• d5ea9b_ appears in the current release, SCOPe 2.08