![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
![]() | Protein Nucleotide excision repair enzyme UvrB, N-terminal domain [418968] (2 species) contains large insertions in the AAA domain |
![]() | Species Thermus thermophilus [TaxId:274] [419432] (2 PDB entries) |
![]() | Domain d1c4oa1: 1c4o A:2-409 [32415] Other proteins in same PDB: d1c4oa2 complexed with bog, so4 has additional subdomain(s) that are not in the common domain |
PDB Entry: 1c4o (more details), 1.5 Å
SCOPe Domain Sequences for d1c4oa1:
Sequence, based on SEQRES records: (download)
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB, N-terminal domain {Thermus thermophilus [TaxId: 274]} tfryrgpspkgdqpkaiaglvealrdgerfvtllgatgtgktvtmakviealgrpalvla pnkilaaqlaaefrelfpenaveyfisyydyyqpeayvpgkdlyiekdasinpeierlrh sttrslltrrdvivvasvsaiyglgdpreyrarnlvvergkpyprevllerllelgyqrn didlspgrfrakgevleifpayetepirvelfgdeverisqvhpvtgerlrelpgfvlfp athylspegleeilkeiekelwervryfeergevlyaqrlkertlydlemlrvmgtcpgv enyaryftgkapgeppytlldyfpedflvfldeshvtvpqlqgmyrgdyarkktlvdygf rlpsaldnrplrfeeflervsqvvfvsatpgpfelahsgrvveqiirp
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB, N-terminal domain {Thermus thermophilus [TaxId: 274]} tfryrgpspkgdqpkaiaglvealrdgerfvtllgatgtgktvtmakviealgrpalvla pnkilaaqlaaefrelfpenaveyfisyydyyqpeayvpgkdlyiekdasinpeierlrh sttrslltrrdvivvasvsaiyglgdpreyrarnlvgfvlfpathylspegleeilkeie kelwervryfeergevlyaqrlkertlydlemlrvmgtcpgvenyaryftgkapgeppyt lldyfpedflvfldeshvtvpqlqgmyrgdyarkktlvdygfrlpsaldnrplrfeefle rvsqvvfvsatpgpfelahsgrvveqiirp
Timeline for d1c4oa1: