| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
| Protein automated matches [190453] (26 species) not a true protein |
| Species Shewanella violacea [TaxId:60217] [324148] (2 PDB entries) |
| Domain d5b6qb_: 5b6q B: [324149] automated match to d1cc5a_ complexed with hec, imd |
PDB Entry: 5b6q (more details), 1.78 Å
SCOPe Domain Sequences for d5b6qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b6qb_ a.3.1.0 (B:) automated matches {Shewanella violacea [TaxId: 60217]}
qegkavydkachichsmgvagapkahdaaawepriaqgldtlvstvktgkgamppggmct
dctdedyksaieymsk
Timeline for d5b6qb_: