SCOPe 2.08: Domain d5b6qb_: 5b6q B:

Lineage for d5b6qb_ (5b6q B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (26 species)
   not a true protein

7. Species Shewanella violacea [TaxId:60217] [324148] (2 PDB entries)

8. Domain d5b6qb_: 5b6q B: [324149]
   automated match to d1cc5a_
   complexed with hec, imd

Details for d5b6qb_

PDB Entry: 5b6q, 1.78 Å

PDB Description: crystal structure of monomeric cytochrome c5 from shewanella violacea

PDB Compounds: (B:) Soluble cytochrome cA

SCOPe Domain Sequences for d5b6qb_:

Sequence; same for both SEQRES and ATOM records:

>d5b6qb_ a.3.1.0 (B:) automated matches {Shewanella violacea [TaxId: 60217]}
qegkavydkachichsmgvagapkahdaaawepriaqgldtlvstvktgkgamppggmct
dctdedyksaieymsk

Timeline for d5b6qb_:

• d5b6qb_ first appeared in SCOPe 2.06
  
• d5b6qb_ appears in SCOPe 2.07