![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein multi-copper oxidase CueO, N- and middle domain [418908] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [419322] (38 PDB entries) |
![]() | Domain d5b7ma2: 5b7m A:171-335 [324145] Other proteins in same PDB: d5b7ma3, d5b7mb3, d5b7mc3 automated match to d4e9sa2 complexed with cu |
PDB Entry: 5b7m (more details), 1.8 Å
SCOPe Domain Sequences for d5b7ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b7ma2 b.6.1.3 (A:171-335) multi-copper oxidase CueO, N- and middle domain {Escherichia coli [TaxId: 562]} mlpkqwgiddvpvivqdkkfsadgqidyqldvmtaavgwfgdtlltngaiypqhaaprgw lrlrllngcnarslnfatsdnrplyviasdggllpepvkvselpvlmgerfevlvevndn kpfdlvtlpvsqmgmaiapfdkphpvmriqpiaisasgalpdtls
Timeline for d5b7ma2: